Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable biotin transporter BioY (bioY)

This Recombinant Bacillus subtilis Probable biotin transporter BioY (bioY) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Probable biotin transporter BioY

UniProt

O07620

Expression Region

1-186

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLIDMMHIAIFTALMAVLGFMPPLFLSFTPVPITLQTLGVMLAGSILRPKSAFLSQLV FLLLVAFGAPLLPGGRGGFGVFFGPSAGFLIAYPLASWLISLAANRLRKVTVLRLFFTHI VFGIIFIYLLGIPVQAFIMHIDLSQAAFMSLAYVPGDLIKAAVSAFLAIKITQALSLSDT MFTKGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), CF594 conjugate, 0.1mg/mL
BNC942908-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2908R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF640R conjugate, 0.1mg/mL
BNC400487-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF405S conjugate, 0.1mg/mL
BNC040487-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details