Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

P61636

Expression Region

1-187

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perfluorobutyl Iodide
TRC-P286205-25G 25 g

Perfluorobutyl Iodide

Sign In for Pricing
View Details
Cytokeratin 8 (TS1), CF647 conjugate, 0.1mg/mL
BNC470627-100 1x 100 µL

Cytokeratin 8 (TS1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDGFL3 (NM_016073) Human Over-expression Lysate
LC402497 20 µg

HDGFL3 (NM_016073) Human Over-expression Lysate

Sign In for Pricing
View Details
4,9-Diamantanedicarboxylic acid
TRC-D172920-100MG 100 mg

4,9-Diamantanedicarboxylic acid

Sign In for Pricing
View Details
Cathepsin Z Rabbit Polyclonal Antibody
HA500396 100 µL

Cathepsin Z Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SAR1 (SAR1A) Human Gene Knockout Kit (CRISPR)
KN401450 1 Kit

SAR1 (SAR1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details