Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

P61637

Expression Region

1-187

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd8a AAV siRNA Pooled Vector
15576164 1.0 µg

Cd8a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)
MBS2076452-01 0.1 mL

FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)
MBS2076452-02 0.2 mL

FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)
MBS2076452-03 0.5 mL

FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)
MBS2076452-04 1 mL

FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)
MBS2076452-05 5 mL

FITC-Linked Polyclonal Antibody to Dipeptidase 3 (DPEP3)

Sign In for Pricing
View Details