Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)
This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.
Product Specifications
Product Name Alternative
Accessory gene regulator protein B, EC= 3.4.-.-
UniProt
A6U3C2
Expression Region
1-187
Origin
Staphylococcus aureus (strain JH1)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472446-500 1x 500 µL
GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401018 20 µg
PSP (REG1A) (NM_002909) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC473065-500 1x 500 µL
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA751124 100 µL
EIF3S1 / EIF3J Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
