Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

A6U3C2

Expression Region

1-187

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(RS)-Pantoic Acid Sodium Salt Monohydrate
TRC-P181500-1G 1 g

(RS)-Pantoic Acid Sodium Salt Monohydrate

Sign In for Pricing
View Details
N-(4-Butylphenyl)benzamide
TRC-B806710-1G 1 g

N-(4-Butylphenyl)benzamide

Sign In for Pricing
View Details
(Z)-Chlorfenvinphos
TRC-C324355-50MG 50 mg

(Z)-Chlorfenvinphos

Sign In for Pricing
View Details
IFIT3 Polyclonal Antibody
E-AB-90631-01 60 µL

IFIT3 Polyclonal Antibody

Sign In for Pricing
View Details
IFIT3 Polyclonal Antibody
E-AB-90631-02 120 µL

IFIT3 Polyclonal Antibody

Sign In for Pricing
View Details
IFIT3 Polyclonal Antibody
E-AB-90631-03 200 µL

IFIT3 Polyclonal Antibody

Sign In for Pricing
View Details