What is the catalog number for Recombinant Zea mays CASP-like protein 13?

The catalog number for Recombinant Zea mays CASP-like protein 13 is orb2919240.

What sizes are available for Recombinant Zea mays CASP-like protein 13?

Recombinant Zea mays CASP-like protein 13 is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Zea mays CASP-like protein 13 come in?

Recombinant Zea mays CASP-like protein 13 is available in 2 different pack sizes.

Is Recombinant Zea mays CASP-like protein 13 in stock?

Recombinant Zea mays CASP-like protein 13 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Zea mays CASP-like protein 13

This Recombinant Zea mays CASP-like protein 13 spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

CASP-like protein 13

UniProt

B6U769

Expression Region

1-187

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAAARVVSGVKAEGLLRGACAALAAAAALLLGLSTQTETVLLVRKKGTVKDVQALWVLA MAAASAAGYHLLQLLKCLYLGRGGGRALAWTCLLLDKACAYATFATTVAAAQACVVALDG AHALQWTKLCNIYTRFCEQVAGSLVLGMLAAVGTAVLSAASARNVFRHYYCSSHSPPAPP PETCDAH