Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 212 (Tmem212)

This Recombinant Mouse Transmembrane protein 212 (Tmem212) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Transmembrane protein 212

UniProt

Q8C6V3

Expression Region

1-187

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLYQAAGRTLVTLGGLSIFSGAIAFFPVFSCKLWYTGWSVWIACPIWNGALAVTAGSL VLLAHREWTQRHLWEAVFTFVILSILGCPLHFTVALQSALLGPYCFYSFSGVAGTNYLGY VVTFPFPYTKFPSVCVDPLHYEEYHLTLQVLDLCLSLILFCVSLAVFIKLSARLMQTGYI NGPENPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SEMA4C activation kit by CRISPRa
GA110363 1 Kit

Human SEMA4C activation kit by CRISPRa

Sign In for Pricing
View Details
Human TMEM90A (SYNDIG1L) activation kit by CRISPRa
GA118784 1 Kit

Human TMEM90A (SYNDIG1L) activation kit by CRISPRa

Sign In for Pricing
View Details
(+)-Aromadendrene
TRC-A794200-5MG 5 mg

(+)-Aromadendrene

Sign In for Pricing
View Details
Ckm Mouse Gene Knockout Kit (CRISPR)
KN503375 1 Kit

Ckm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIOX (NM_017584) Human Recombinant Protein
TP310070L 1 mg

MIOX (NM_017584) Human Recombinant Protein

Sign In for Pricing
View Details
1-Octen-3-one
TRC-O239250-5G 5 g

1-Octen-3-one

Sign In for Pricing
View Details