Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 212 (Tmem212)

This Recombinant Mouse Transmembrane protein 212 (Tmem212) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Transmembrane protein 212

UniProt

Q8C6V3

Expression Region

1-187

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLYQAAGRTLVTLGGLSIFSGAIAFFPVFSCKLWYTGWSVWIACPIWNGALAVTAGSL VLLAHREWTQRHLWEAVFTFVILSILGCPLHFTVALQSALLGPYCFYSFSGVAGTNYLGY VVTFPFPYTKFPSVCVDPLHYEEYHLTLQVLDLCLSLILFCVSLAVFIKLSARLMQTGYI NGPENPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4'-Thiobis(6-tert-butyl-o-cresol)
TRC-T475025-1G 1 g

4,4'-Thiobis(6-tert-butyl-o-cresol)

Sign In for Pricing
View Details
KCTD9 (NM_017634) Human Recombinant Protein
TP309801M 100 µg

KCTD9 (NM_017634) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rhesus macaque HVEM/TNFRSF14/CD270 Protein (Fc Tag)
PKSQ050075-01 10 µg

Recombinant Rhesus macaque HVEM/TNFRSF14/CD270 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rhesus macaque HVEM/TNFRSF14/CD270 Protein (Fc Tag)
PKSQ050075-02 50 µg

Recombinant Rhesus macaque HVEM/TNFRSF14/CD270 Protein (Fc Tag)

Sign In for Pricing
View Details
Hemoglobin High Sensitivity Colorimetric Detection Kit
K013-HX5 10 Plates

Hemoglobin High Sensitivity Colorimetric Detection Kit

Sign In for Pricing
View Details
Dxd Rabbit Monoclonal Antibody [Clone ID: 1A12]
TA421202 100 µg

Dxd Rabbit Monoclonal Antibody [Clone ID: 1A12]

Sign In for Pricing
View Details