Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 212 (Tmem212)

This Recombinant Mouse Transmembrane protein 212 (Tmem212) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Transmembrane protein 212

UniProt

Q8C6V3

Expression Region

1-187

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLYQAAGRTLVTLGGLSIFSGAIAFFPVFSCKLWYTGWSVWIACPIWNGALAVTAGSL VLLAHREWTQRHLWEAVFTFVILSILGCPLHFTVALQSALLGPYCFYSFSGVAGTNYLGY VVTFPFPYTKFPSVCVDPLHYEEYHLTLQVLDLCLSLILFCVSLAVFIKLSARLMQTGYI NGPENPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescein DHPE
23304-AAT 5 mg

Fluorescein DHPE

Sign In for Pricing
View Details
THBS3 Human Gene Knockout Kit (CRISPR)
KN414968 1 Kit

THBS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
E Cadherin (CDH1) Goat Polyclonal Antibody
AB0115-200 600 µg

E Cadherin (CDH1) Goat Polyclonal Antibody

Sign In for Pricing
View Details
p107 (RBL1) (NM_183404) Human Over-expression Lysate
LY403655 100 µg

p107 (RBL1) (NM_183404) Human Over-expression Lysate

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL
BNC402759-500 1x 500 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gfra1 activation kit by CRISPRa
GA201595 1 Kit

Mouse Gfra1 activation kit by CRISPRa

Sign In for Pricing
View Details