Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosphaera stadtmanae UPF0290 protein Msp_0385 (Msp_0385)

This Recombinant Methanosphaera stadtmanae UPF0290 protein Msp_0385 (Msp_0385) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

UPF0290 protein Msp_0385

UniProt

Q2NHB7

Expression Region

1-187

Origin

Methanosphaera stadtmanae (strain DSM 3091)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDILTLIFYSIYLMIPAYLANGSALVFGGGTPMDFGHYCWDNRRLIGNGVTWRGTVCGGL FGMVIGGILGLLATYGIGSYFFNITASQITFMSGFVPQGLLVGFLLGFGALIGDAIGSFL KRRLNFERGKPVPLLDQLDFVVVSLLFVSTVVSLSLEMIVIIILVSIFLHLGANMFAYMI NLKDVWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details