Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q6G7S1

Expression Region

1-187

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFIFTL ITNISFYLIRRYAHGAHAPSSFWCYIESITLFIVLPLLVLHFHINETLMMFLALISVGVV IKYAPAATKKKPIPARLVKQKRYFSIIISTILFIITLFVKEPYTQFIQLGIIIQAITLLP IYYSKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse OX40L protein (His Tag)
PKSM041488-01 20 µg

Recombinant Mouse OX40L protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse OX40L protein (His Tag)
PKSM041488-02 100 µg

Recombinant Mouse OX40L protein (His Tag)

Sign In for Pricing
View Details
Allyl Mercaptan (>75%)
TRC-A614543-250MG 250 mg

Allyl Mercaptan (>75%)

Sign In for Pricing
View Details
ACSM2B (NM_182617) Human Recombinant Protein
TP314283 20 µg

ACSM2B (NM_182617) Human Recombinant Protein

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF405S conjugate, 0.1mg/mL
BNC043811-500 1x 500 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM22 (NM_006074) Human Over-expression Lysate
LC401829 20 µg

TRIM22 (NM_006074) Human Over-expression Lysate

Sign In for Pricing
View Details