Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q6GF36

Expression Region

1-187

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTLAYILNIFIFTL ITNISFYLIRRYAHGAHAPSSFWCYIESITLFIVLPLLVLHFHINETLMMFLALLSVGVV IKYAPAATKKKPIPARLVKQKRYFSIIISTILFIITLFVKEPYTQFIQLGIIIQAITLLP IYYSKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARID5A Human Gene Knockout Kit (CRISPR)
KN416294 1 Kit

ARID5A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(4-Acetoxyphenyl)ethanol
TRC-A167730-5G 5 g

2-(4-Acetoxyphenyl)ethanol

Sign In for Pricing
View Details
ABCA8 Human Gene Knockout Kit (CRISPR)
KN415060 1 Kit

ABCA8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TSPO Antibody
KC-24915-01 50 μL

TSPO Antibody

Sign In for Pricing
View Details
TSPO Antibody
KC-24915-02 100 µL

TSPO Antibody

Sign In for Pricing
View Details
TSPO Antibody
KC-24915-03 1 mL

TSPO Antibody

Sign In for Pricing
View Details