Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q6GF36

Expression Region

1-187

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTLAYILNIFIFTL ITNISFYLIRRYAHGAHAPSSFWCYIESITLFIVLPLLVLHFHINETLMMFLALLSVGVV IKYAPAATKKKPIPARLVKQKRYFSIIISTILFIITLFVKEPYTQFIQLGIIIQAITLLP IYYSKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2T34 Human Gene Knockout Kit (CRISPR)
KN418623 1 Kit

OR2T34 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Protein A Texas Red Colloidal Gold, 1mL 30nm
TGP-01-30 1 mL

Protein A Texas Red Colloidal Gold, 1mL 30nm

Sign In for Pricing
View Details
Biotin Conjugated Morniga M Lectin (black mulberry) -MNA-M-
BA-9004-1 1 mg

Biotin Conjugated Morniga M Lectin (black mulberry) -MNA-M-

Sign In for Pricing
View Details
ABHD14B (NM_001146314) Human Over-expression Lysate
LC431791 20 µg

ABHD14B (NM_001146314) Human Over-expression Lysate

Sign In for Pricing
View Details
MYOD1 pSer200 Rabbit Polyclonal Antibody
AP02375PU-N 100 µL

MYOD1 pSer200 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BG-Maleimide
12566-AAT 1 mg

BG-Maleimide

Sign In for Pricing
View Details