Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q8NVK5

Expression Region

1-187

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFIFTL ITNISFYLIRRYAHGAHAPSSFWCYIESITLFIVLPLLVLHFHINETLMMFLALISVGVV IKYAPAATKKKPIPARLVKQKRYFSIIISTILFIITLFVKEPYTQFIQLGIIIQAITLLP IYYSKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODN 1018 (sodium)
HY-150724C-01 1 mg

ODN 1018 (sodium)

Sign In for Pricing
View Details
ODN 1018 (sodium)
HY-150724C-02 5 mg

ODN 1018 (sodium)

Sign In for Pricing
View Details
ODN 1018 (sodium)
HY-150724C-03 10 mg

ODN 1018 (sodium)

Sign In for Pricing
View Details
Lentiviral human MYT1 sgRNA gene knockout kit - Lentiviral human MYT1 sgRNA gene knockout kit (plasmid)
GTR15360350 1 Vial

Lentiviral human MYT1 sgRNA gene knockout kit - Lentiviral human MYT1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Clec4a3 (NM_153197) Mouse Untagged Clone
MC201393 10 µg

Clec4a3 (NM_153197) Mouse Untagged Clone

Sign In for Pricing
View Details
PSMB4 Rabbit Polyclonal Antibody
orb330846 100 µL

PSMB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details