Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P39438

Expression Region

1-187

Origin

Azospirillum brasilense

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIDQYLDAALLGLIEGLTEFLPVSSTGHLIIFDTLLGFEGPPGKVFEVVIQLGAILAIC TVYFARLWKVVTGLKDDPGARHFAMAVILAFLPAMVLGAALHGVIKAVLFNPTVVSIALI LGGVAILMAERLVPAPRYHQIERFPAPLALKIGLCQCLALVPGVSRSGATILGSLLMGVD RRTAAEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC401034 Human shRNA Lentiviral Particle (Locus ID 401034)
TL320159V 500 µL Each

LOC401034 Human shRNA Lentiviral Particle (Locus ID 401034)

Sign In for Pricing
View Details
FCRL5 CRISPR Knock Out 293T Cell Line (Human)
20411141 1x 10^6 Cells / 1.0 mL

FCRL5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
E2F8 Antibody
orb1249566 0.1 mg

E2F8 Antibody

Sign In for Pricing
View Details
IRAKM Antibody Blocking Peptide
orb1510793 500 µg

IRAKM Antibody Blocking Peptide

Sign In for Pricing
View Details
Monkey Macrophage Migration Inhibitory Factor ELISA Kit
MBS006837-01 48 Well

Monkey Macrophage Migration Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details
Monkey Macrophage Migration Inhibitory Factor ELISA Kit
MBS006837-02 96 Well

Monkey Macrophage Migration Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details