Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P39438

Expression Region

1-187

Origin

Azospirillum brasilense

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIDQYLDAALLGLIEGLTEFLPVSSTGHLIIFDTLLGFEGPPGKVFEVVIQLGAILAIC TVYFARLWKVVTGLKDDPGARHFAMAVILAFLPAMVLGAALHGVIKAVLFNPTVVSIALI LGGVAILMAERLVPAPRYHQIERFPAPLALKIGLCQCLALVPGVSRSGATILGSLLMGVD RRTAAEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (PE)
126737-PE 100 µL

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (PE)

Sign In for Pricing
View Details
anti-CBFA2T3
YF-PA10695 50 ul

anti-CBFA2T3

Sign In for Pricing
View Details
Lentiviral mouse Fscb shRNA (UAS) - Lentiviral mouse Fscb shRNA (UAS, GFP) (100)
GTR15192705 1 Vial

Lentiviral mouse Fscb shRNA (UAS) - Lentiviral mouse Fscb shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CCHCR1 Rabbit Polyclonal Antibody
TA325041 400 µL

CCHCR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLET1 siRNA (Mouse)
orb1839628-01 15 nmol

PLET1 siRNA (Mouse)

Sign In for Pricing
View Details
PLET1 siRNA (Mouse)
orb1839628-02 30 nmol

PLET1 siRNA (Mouse)

Sign In for Pricing
View Details