Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P39438

Expression Region

1-187

Origin

Azospirillum brasilense

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIDQYLDAALLGLIEGLTEFLPVSSTGHLIIFDTLLGFEGPPGKVFEVVIQLGAILAIC TVYFARLWKVVTGLKDDPGARHFAMAVILAFLPAMVLGAALHGVIKAVLFNPTVVSIALI LGGVAILMAERLVPAPRYHQIERFPAPLALKIGLCQCLALVPGVSRSGATILGSLLMGVD RRTAAEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gabrq 3'UTR GFP Stable Cell Line
TU254902 1.0 mL

Gabrq 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial
MBS1445501-01 0.02 mg (E-Coli)

Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial

Sign In for Pricing
View Details
Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial
MBS1445501-02 0.1 mg (E-Coli)

Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial

Sign In for Pricing
View Details
Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial
MBS1445501-03 0.02 mg (Yeast)

Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial

Sign In for Pricing
View Details
Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial
MBS1445501-04 0.1 mg (Yeast)

Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial

Sign In for Pricing
View Details
Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial
MBS1445501-05 0.02 mg (Baculovirus)

Recombinant Bovine Endothelin-converting enzyme 2 (ECE2) , partial

Sign In for Pricing
View Details