Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max CASP-like protein 6

This Recombinant Glycine max CASP-like protein 6 spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

CASP-like protein 6

UniProt

C6TBD0

Expression Region

1-188

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGVESKEREVMVAKPVAVVGVCDLLLRLLAFTVTLVAAIVIAVDKQTKLVPIQLSDSFP PLNVPLTAKWHQMSAFVYFLVTNAIACTYAAMSLLLALVNRGKSKGLWTLIAVLDTFMVA LLFSGNGAAAAVGILGYKGNSHVNWNKVCNVFGKFCDQMAASIGVSLIGSLAFLLLVVIP VVRLHRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 430 Anti-human CD16 Antibody *3G8*
10161030-AAT 100 Tests

IFluor® 430 Anti-human CD16 Antibody *3G8*

Sign In for Pricing
View Details
Human PTOV1 activation kit by CRISPRa
GA110020 1 Kit

Human PTOV1 activation kit by CRISPRa

Sign In for Pricing
View Details
TRIM43 Polyclonal Antibody
E-AB-90849-01 60 µL

TRIM43 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM43 Polyclonal Antibody
E-AB-90849-02 120 µL

TRIM43 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM43 Polyclonal Antibody
E-AB-90849-03 200 µL

TRIM43 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS700442 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details