Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max CASP-like protein 6

This Recombinant Glycine max CASP-like protein 6 spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

CASP-like protein 6

UniProt

C6TBD0

Expression Region

1-188

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGVESKEREVMVAKPVAVVGVCDLLLRLLAFTVTLVAAIVIAVDKQTKLVPIQLSDSFP PLNVPLTAKWHQMSAFVYFLVTNAIACTYAAMSLLLALVNRGKSKGLWTLIAVLDTFMVA LLFSGNGAAAAVGILGYKGNSHVNWNKVCNVFGKFCDQMAASIGVSLIGSLAFLLLVVIP VVRLHRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIAM2 (NM_001010927) Human Over-expression Lysate
LY423235 100 µg

TIAM2 (NM_001010927) Human Over-expression Lysate

Sign In for Pricing
View Details
CRYBA4 Human Gene Knockout Kit (CRISPR)
KN422420 1 Kit

CRYBA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SR 9009
TRC-S684255-25MG 25 mg

SR 9009

Sign In for Pricing
View Details
5-Acenaphthenamine
TRC-A130735-5MG 5 mg

5-Acenaphthenamine

Sign In for Pricing
View Details
Parkins’ Catalyst
TRC-P205660-5MG 5 mg

Parkins’ Catalyst

Sign In for Pricing
View Details
EXTRAClean Plasma/Serum Exosome Purification and RNA Isolation Maxi Kit
73120 15 Preparations

EXTRAClean Plasma/Serum Exosome Purification and RNA Isolation Maxi Kit

Sign In for Pricing
View Details