Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus haemolyticus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q4L7S0

Expression Region

1-188

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKAIDNKIEQFALYLQRKNNLDHIQFLKVRLGLQVVVSNLAKTIVTYGVALIFHTFLYTL FTHVSYFLVRRYAHGAHAKSSLLCHVQNLALFVALPWLLVYFQVNLGIMYSVVAIGTVLI IYYAPSATKKQPIPSHLKMKKKLLSIIITMVLLIISFLAPEPFKQLILLGITLESITLLP IFFPREDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRHL (NM_001089591) Human Over-expression Lysate
LC421339 20 µg

UQCRHL (NM_001089591) Human Over-expression Lysate

Sign In for Pricing
View Details
Rgs14 Mouse Gene Knockout Kit (CRISPR)
KN514731 1 Kit

Rgs14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), 1mg/mL
BNUM2231-50 1x 50 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), 1mg/mL

Sign In for Pricing
View Details
Palladium(II) Acetylacetonate
TRC-P578015-250MG 250 mg

Palladium(II) Acetylacetonate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS806512 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
FOS (Ab-32) Antibody
8B8212-AAT 50 µg

FOS (Ab-32) Antibody

Sign In for Pricing
View Details