Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus haemolyticus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q4L7S0

Expression Region

1-188

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKAIDNKIEQFALYLQRKNNLDHIQFLKVRLGLQVVVSNLAKTIVTYGVALIFHTFLYTL FTHVSYFLVRRYAHGAHAKSSLLCHVQNLALFVALPWLLVYFQVNLGIMYSVVAIGTVLI IYYAPSATKKQPIPSHLKMKKKLLSIIITMVLLIISFLAPEPFKQLILLGITLESITLLP IFFPREDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEIS2 (NM_002399) Human Over-expression Lysate
LC419351 20 µg

MEIS2 (NM_002399) Human Over-expression Lysate

Sign In for Pricing
View Details
P34 / cdk1 (CDK1/873), CF405S conjugate, 0.1mg/mL
BNC040873-500 1x 500 µL

P34 / cdk1 (CDK1/873), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Chloro-7-nitro-2(3H)-benzoxazolone
TRC-C373915-500MG 500 mg

5-Chloro-7-nitro-2(3H)-benzoxazolone

Sign In for Pricing
View Details
CD20 (MS4A1) Rabbit Polyclonal Antibody
TA378687 100 µL

CD20 (MS4A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F8 Antibody
KC-47569-01 50 μL

F8 Antibody

Sign In for Pricing
View Details
F8 Antibody
KC-47569-02 100 µL

F8 Antibody

Sign In for Pricing
View Details