Recombinant Chicken PRA1 family protein 3 (ARL6IP5)
This Recombinant Chicken PRA1 family protein 3 (ARL6IP5) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
PRA1 family protein 3, ADP-ribosylation factor-like protein 6-interacting protein 5, ARL-6-interacting protein 5, Aip-5
UniProt
Q5F433
Expression Region
1-188
Origin
Gallus gallus (Chicken)
Field of Research
Neuroscience; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEVQVAPLRSWEDFFPGSDRFGRPDFKDISKWNNRVVNNLLYYQTNYLMVAAAVVAIVGF LSPLNMLIGGTVVILVFLGFVWVSHNKDILRRMKKQYPTTFVIVIMLSSYFLISYLGDVM VFMFGITLPLLLMFIHASLRLRNIKNKLENKKEEIGLKKTPMGIILDALEQQEDNINKLA SYIPKVKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details