Recombinant UPF0059 membrane protein yebN (yebN)
This Recombinant UPF0059 membrane protein yebN (yebN) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
UPF0059 membrane protein yebN
UniProt
Q7UCL3
Expression Region
1-188
Origin
Shigella flexneri
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNITATVLLAFGMSMDAFAASIGKGAPLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042712-500 1x 500 µL
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401803-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details