Recombinant Caulobacter crescentus Probable intracellular septation protein A (CC_3678)
This Recombinant Caulobacter crescentus Probable intracellular septation protein A (CC_3678) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
Q9A288
Expression Region
1-188
Origin
Caulobacter crescentus (strain ATCC 19089 / CB15)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRTVVDYGAAIAFGVAYFVTKDFQKATWVLVAASAAALAIGYAVERRLAMLPLFFGGMAL VFGTLGLIFGSDVFVKIKVTVINLALASFLVGGVLLKRQPLKVIMGEALHLPDAAWRTLT LRYGAYFAFVAIINEVVRNTQDTDTWVKFRLALLPVALVFVATQLPFMMKHMAKGDDAKA VEPPDAGF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-500 1x 500 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740460-100 1x 100 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details