Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychromonas ingrahamii Probable intracellular septation protein A (Ping_1054)

This Recombinant Psychromonas ingrahamii Probable intracellular septation protein A (Ping_1054) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

A1STS8

Expression Region

1-189

Origin

Psychromonas ingrahamii (strain 37)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQFFEFIPLIIFFVVFKTTDIYIATGALIVSMGLMLAFNYYKDGKVEKMQVITFGMVLV FGTLTIVLHDDVFIKWKVTVVYALFSLALLVSQFFYKKPIIKQMLSKEINLPANIWNNLN MAWALLFAVLSAVNVYVAFSLSQETWVNFKVFGLLAITLAFTLLSGLYIYKYLPATAEKK ISANKNPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-500 1x 500 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF594 conjugate, 0.1mg/mL
BNC940889-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL
BNC472843-500 1x 500 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details