Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

A8Z4U0

Expression Region

1-189

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD4 Polyclonal Antibody
E-AB-52165-01 20 µL

PDCD4 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD4 Polyclonal Antibody
E-AB-52165-02 60 µL

PDCD4 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD4 Polyclonal Antibody
E-AB-52165-03 120 µL

PDCD4 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD4 Polyclonal Antibody
E-AB-52165-04 200 µL

PDCD4 Polyclonal Antibody

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL
BNCB1620-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), Biotin conjugate, 0.1mg/mL
BNCB0303-500 1x 500 µL

Neurofilament (NF-L) (NR-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details