Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006)

This Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Uncharacterized protein CT_006

UniProt

O84009

Expression Region

1-189

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSTVAPIKGQDHFLNLVFPERVAAAYMSPLAQKYPKAALSIASLAGFLLGILKLITFPV LCAAGLFVFPIRGLISCLFHKSFQGCSGYVLATFLSLFSLALTIVGIVSCITWAPGFIFP MISVSIAFATVETCFQIYTHLFPALEHKPSSSLKIEIAAAKLPRSSSAPDLNYPSLPTQS ASPSQRFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Methoxy-ω-Hydroxy PEG
125000-0.5G 5 g

Ɑ-Methoxy-ω-Hydroxy PEG

Sign In for Pricing
View Details
4-Fluoroanisole
TRC-F587680-1G 1 g

4-Fluoroanisole

Sign In for Pricing
View Details
FMRP (FMR1) (NM_002024) Human Over-expression Lysate
LY419580 100 µg

FMRP (FMR1) (NM_002024) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS504197 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Recombinant Human PDE1B Protein (His & GST Tag)
PKSH031014 50 µg

Recombinant Human PDE1B Protein (His & GST Tag)

Sign In for Pricing
View Details
Bax (BAX/962), Biotin conjugate, 0.1mg/mL
BNCB0962-100 1x 100 µL

Bax (BAX/962), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details