Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006)

This Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Uncharacterized protein CT_006

UniProt

O84009

Expression Region

1-189

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSTVAPIKGQDHFLNLVFPERVAAAYMSPLAQKYPKAALSIASLAGFLLGILKLITFPV LCAAGLFVFPIRGLISCLFHKSFQGCSGYVLATFLSLFSLALTIVGIVSCITWAPGFIFP MISVSIAFATVETCFQIYTHLFPALEHKPSSSLKIEIAAAKLPRSSSAPDLNYPSLPTQS ASPSQRFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cfap161 activation kit by CRISPRa
GA210260 1 Kit

Mouse Cfap161 activation kit by CRISPRa

Sign In for Pricing
View Details
Acenocoumarol
TRC-A130800-50MG 50 mg

Acenocoumarol

Sign In for Pricing
View Details
OA1 (GPR143) Rabbit Polyclonal Antibody
TA376726 100 µL

OA1 (GPR143) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Kininogen-1 Antibody
RC-15976-01 50 μL

Recombinant Kininogen-1 Antibody

Sign In for Pricing
View Details
Recombinant Kininogen-1 Antibody
RC-15976-02 100 µL

Recombinant Kininogen-1 Antibody

Sign In for Pricing
View Details
Recombinant Kininogen-1 Antibody
RC-15976-03 1 mL

Recombinant Kininogen-1 Antibody

Sign In for Pricing
View Details