Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q2FF88

Expression Region

1-189

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS503505 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Tissue Total RNA, Colon: left
CR562427 5 µg

Tissue Total RNA, Colon: left

Sign In for Pricing
View Details
trans-4-Cyano Cabastine
TRC-T358380-50MG 50 mg

trans-4-Cyano Cabastine

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF405S conjugate, 0.1mg/mL
BNC042041-500 1x 500 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parvalbumin (PVALB) Rabbit Monoclonal Antibody
TA422938 100 µL

Parvalbumin (PVALB) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), CF405S conjugate, 0.1mg/mL
BNC043350-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details