Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q2FF88

Expression Region

1-189

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP9YP35 Protein Vector (Human) (pPM-C-His)
PV142465 500 ng

USP9YP35 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SLC25A12 Rabbit Polyclonal Antibody (HRP)
orb2120120 100 µL

SLC25A12 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-Histone H3 (10A10) Mouse Monoclonal Antibody
MA3025-.1 100 µL

Anti-Histone H3 (10A10) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD162 Antibody HRP Conjugated
MBS9460982-01 0.1 mL

CD162 Antibody HRP Conjugated

Sign In for Pricing
View Details
CD162 Antibody HRP Conjugated
MBS9460982-02 5x 0.1 mL

CD162 Antibody HRP Conjugated

Sign In for Pricing
View Details
3-Ethyl-4-Methyl-1H-Pyrazole-5-Carboxylic Acid
HNB12938-01 0.5 g

3-Ethyl-4-Methyl-1H-Pyrazole-5-Carboxylic Acid

Sign In for Pricing
View Details