Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q2FWM7

Expression Region

1-189

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCARA5 (NM_173833) Human Recombinant Protein
TP319554L 1 mg

SCARA5 (NM_173833) Human Recombinant Protein

Sign In for Pricing
View Details
ECHDC3 (NM_024693) Human Recombinant Protein
TP303685L 1 mg

ECHDC3 (NM_024693) Human Recombinant Protein

Sign In for Pricing
View Details
GlycoLinerTM 650/670 Cell Surface Glycoprotein Labeling Kit, 100 Labelings
#30146-T 1 Kit

GlycoLinerTM 650/670 Cell Surface Glycoprotein Labeling Kit, 100 Labelings

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS516028 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Chlorfenvinphos
TRC-C324360-1G 1 g

Chlorfenvinphos

Sign In for Pricing
View Details
Cd3e Mouse Gene Knockout Kit (CRISPR)
KN502914 1 Kit

Cd3e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details