Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q2FWM7

Expression Region

1-189

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1,1,3,10,11-Hexachloroundecane
TRC-H294793-5MG 5 mg

1,1,1,3,10,11-Hexachloroundecane

Sign In for Pricing
View Details
Fmoc-Asn (Trt) TentaGel® R PHB Resin
RA1304.25G 25 g

Fmoc-Asn (Trt) TentaGel® R PHB Resin

Sign In for Pricing
View Details
Alg2 Mouse Gene Knockout Kit (CRISPR)
KN501138 1 Kit

Alg2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AF488-Goat Anti-Mouse IgM (H+L)
RD90763A-01 120 μL

AF488-Goat Anti-Mouse IgM (H+L)

Sign In for Pricing
View Details
AF488-Goat Anti-Mouse IgM (H+L)
RD90763A-02 500 µL

AF488-Goat Anti-Mouse IgM (H+L)

Sign In for Pricing
View Details
AF488-Goat Anti-Mouse IgM (H+L)
RD90763A-03 1 mL

AF488-Goat Anti-Mouse IgM (H+L)

Sign In for Pricing
View Details