Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Pseudomonas fluorescens Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q4K4W5

Expression Region

1-189

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFWLLAIFAYLLGSLSFAILLSRLTGNPDPRMSGSGNAGATNMLRLAGKKLAVLTLLGDL CKGLAPVLIAHLAGLSLQQQAWVGLYAVLGHLFPLYFRFRGGKGVATAAGMLLGLYPPAA LLAIAAWALTFYLTRTSSLAALIATPLTLPLLAWQEPEALLPMSVLTLLIVWRHRGNLRD LFAGRERHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF568 conjugate, 0.1mg/mL
BNC681475-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF568 conjugate, 0.1mg/mL
BNC681953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details