Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q5HEG5

Expression Region

1-189

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGB Antibody
OACD03488-1ML 1 mL

FGB Antibody

Sign In for Pricing
View Details
NDEL1 (D-5)
sc-365094 200 µg/mL

NDEL1 (D-5)

Sign In for Pricing
View Details
Recombinant Human USP1 Protein, N-His
HF660012-01 50 µg

Recombinant Human USP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human USP1 Protein, N-His
HF660012-02 100 µg

Recombinant Human USP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human USP1 Protein, N-His
HF660012-03 1 mg

Recombinant Human USP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SPAG16, His-tagged
SPAG16-2892H 25 µg

Recombinant Human SPAG16, His-tagged

Sign In for Pricing
View Details