Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium radiobacter Putative K (+) -stimulated pyrophosphate-energized sodium pump (hppA)

This Recombinant Rhizobium radiobacter Putative K (+) -stimulated pyrophosphate-energized sodium pump (hppA) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Putative K (+) -stimulated pyrophosphate-energized sodium pump, EC= 3.6.1.1, Membrane-bound sodium-translocating pyrophosphatase, Pyrophosphate-energized inorganic pyrophosphatase, Na (

UniProt

Q8VPZ0

Expression Region

1-189

Origin

Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGGIAEMAELGPEVRKTTDKLDSVGNTTAAIAKGFAIGSAALTALALFTAFAEEIAKNPK LTGLLVDGHLVVNLTEPGVIIGIFLGATLPFLVCAFTMEAVGKAAFEMIEEVRRQFREIP GIMEGTGRPDYAKCVDISTKAAIREMMLPGVFAVGAPLIVGFLLGAKALAGFLAGVTASG VLLAIFSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANAPC11, Control Peptide (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882)
149429 50 µg

ANAPC11, Control Peptide (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882)

Sign In for Pricing
View Details
Butylphthalide Impurity 55
RM-B212555-01 10 mg

Butylphthalide Impurity 55

Sign In for Pricing
View Details
Butylphthalide Impurity 55
RM-B212555-02 25 mg

Butylphthalide Impurity 55

Sign In for Pricing
View Details
Butylphthalide Impurity 55
RM-B212555-03 50 mg

Butylphthalide Impurity 55

Sign In for Pricing
View Details
Butylphthalide Impurity 55
RM-B212555-04 100 mg

Butylphthalide Impurity 55

Sign In for Pricing
View Details
Olfr513 HDR Plasmid (m)
sc-434835-HDR 20 µg

Olfr513 HDR Plasmid (m)

Sign In for Pricing
View Details