Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0785.1 (MJ0785.1)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0785.1 (MJ0785.1) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0785.1

UniProt

P81231

Expression Region

1-189

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNKCGTMRGESVYLAYPFILGSVIFVEFFIFGLVYLTFGLGLKTIIITSGVILICLLP ISIILIRLFIKSIAGKNKGKLIKKYTKLKILNKKYKILKVLLFIVGINFYLFGNLVSLNI NPYTKFVLYSISAFFIIISIVVGDVIVEFYENGVFINPLGFYKWGEVGKEDLNDRLILKI DKLVIECKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM105B (OTULIN) Human Gene Knockout Kit (CRISPR)
KN424840 1 Kit

FAM105B (OTULIN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Apoa2 activation kit by CRISPRa
GA200237 1 Kit

Mouse Apoa2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS801383 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Recombinant Human CLK3 Protein (GST Tag)
PKSH031459 50 µg

Recombinant Human CLK3 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Rat TGFBR2 Protein (Fc Tag)
PKSR030350 100 µg

Recombinant Rat TGFBR2 Protein (Fc Tag)

Sign In for Pricing
View Details
Adcy1 Mouse Gene Knockout Kit (CRISPR)
KN500886 1 Kit

Adcy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details