Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0785.1 (MJ0785.1)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0785.1 (MJ0785.1) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0785.1

UniProt

P81231

Expression Region

1-189

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNKCGTMRGESVYLAYPFILGSVIFVEFFIFGLVYLTFGLGLKTIIITSGVILICLLP ISIILIRLFIKSIAGKNKGKLIKKYTKLKILNKKYKILKVLLFIVGINFYLFGNLVSLNI NPYTKFVLYSISAFFIIISIVVGDVIVEFYENGVFINPLGFYKWGEVGKEDLNDRLILKI DKLVIECKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM156B (NM_001099684) Human Over-expression Lysate
LC420495 20 µg

FAM156B (NM_001099684) Human Over-expression Lysate

Sign In for Pricing
View Details
HLA Class II DR Mouse Monoclonal Antibody [Clone ID: EDU-1]
AM26129PU-N 100 µg

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: EDU-1]

Sign In for Pricing
View Details
Tylvalosin-d9
TRC-T898212-2.5MG 2.5 mg

Tylvalosin-d9

Sign In for Pricing
View Details
Coelenterazine FCP
#10117 1x 50 µg

Coelenterazine FCP

Sign In for Pricing
View Details
2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride
TRC-D367020-10MG 10 mg

2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride

Sign In for Pricing
View Details
Plant Flavonoids Colorimetric Assay Kit
E-BC-K284-M-01 48 T (32 samples)

Plant Flavonoids Colorimetric Assay Kit

Sign In for Pricing
View Details