Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 8

This Recombinant Zea mays CASP-like protein 8 spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

CASP-like protein 8

UniProt

B6TGJ8

Expression Region

1-190

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTSLLGSDAERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKA MVLLVAAAAAAAGYSLLQAARCCCCVALLRTSIRPRARLLLAWCVFACDQALAYALLAAV VAALQASVVAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFR LYGAKATTTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitro-5(2H)-isoxazolone Pyridinium Salt
TRC-N900958-500MG 500 mg

4-Nitro-5(2H)-isoxazolone Pyridinium Salt

Sign In for Pricing
View Details
CD1C polyclonal antibody
E43P0187P 100 µL

CD1C polyclonal antibody

Sign In for Pricing
View Details
PDE5 inhibitor 42
LMB44928-01 25 mg

PDE5 inhibitor 42

Sign In for Pricing
View Details
PDE5 inhibitor 42
LMB44928-02 50 mg

PDE5 inhibitor 42

Sign In for Pricing
View Details
PDE5 inhibitor 42
LMB44928-03 100 mg

PDE5 inhibitor 42

Sign In for Pricing
View Details
MYCL Polyclonal Antibody, HRP Conjugated
bs-24627R-HRP 100 µL

MYCL Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details