Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol-3-phosphate acyltransferase 2 (plsY2)

This Recombinant Glycerol-3-phosphate acyltransferase 2 (plsY2) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase 2, Acyl-PO4 G3P acyltransferase 2, Acyl-phosphate--glycerol-3-phosphate acyltransferase 2, G3P acyltransferase 2, GPAT 2, EC= 2.3.1.n3, Lys

UniProt

Q81N43

Expression Region

1-190

Origin

Bacillus anthracis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNILTLILSYLIGSISFALIVGKMFYKKDIRDYGSGNLGATNAYRVLGIKAGVIVAIADI LKGTFACLLPLILSSTINPIVCGLLAILGHIFSVFASFKGGKAVATATGVFLFLSPLGVL VGFVVFVLTLLFTKYVSLSSMLAGIALFIYSLIFEDKVIIALSLLIIVSIIILHRQNIKR ILNGTENKIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF594 conjugate, 0.1mg/mL
BNC941856-100 1x 100 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF740 conjugate, 0.1mg/mL
BNC741968-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details