Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_182225 (PHYPADRAFT_182225)

This Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_182225 (PHYPADRAFT_182225) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

CASP-like protein PHYPADRAFT_182225

UniProt

A9S848

Expression Region

1-191

Origin

Physcomitrella patens subsp. patens (Moss)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAADSATNNSKDTHFYGKSRAENRRRSDAMLLLFRALTFSFSLAAVVVMGTNRYRINPQ LKVSWYDFEPYRYVLAVNAIICIYSFVETWLAVYTYLQGSYLLPEIFQVWFDYGHDQGFA YLLFSANSAGVAMAQLLQSGNTLIHGAYHCTEAGGYCTQARVSIALGFVAFLFLALSSLL TGLRVARWYLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF647 conjugate, 0.1mg/mL
BNC471224-100 1x 100 µL

HCG-beta (HCGb/54+ HCGb/459), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF740 conjugate, 0.1mg/mL
BNC740640-500 1x 500 µL

CD34 (QBEnd/10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL
BNC042013-100 1x 100 µL

CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details