Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus carnosus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

B9DML4

Expression Region

1-191

Origin

Staphylococcus carnosus (strain TM300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKVLERKIDAWAQALQKRNNLDRIAYLKIKLGLEVFFNNLFKTIVVYGLALLFHVFLYT LTVHLSYFAIRHYAHGAHAKSTFACYIESIILFVILPWILIKVDIPQIFMIVLAAVAFIL ICLYSPAITRKQPIPNHMRKKKKITAIFVAGILLIISFFIKQPFNELVQLGIVLIGAAQL PIFFPKQTKEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,6'-Disinapoyl sucrose
MBS3607990-01 5 mg

3,6'-Disinapoyl sucrose

Sign In for Pricing
View Details
3,6'-Disinapoyl sucrose
MBS3607990-02 10 mg

3,6'-Disinapoyl sucrose

Sign In for Pricing
View Details
3,6'-Disinapoyl sucrose
MBS3607990-03 25 mg

3,6'-Disinapoyl sucrose

Sign In for Pricing
View Details
3,6'-Disinapoyl sucrose
MBS3607990-04 50 mg

3,6'-Disinapoyl sucrose

Sign In for Pricing
View Details
3,6'-Disinapoyl sucrose
MBS3607990-05 5x 50 mg

3,6'-Disinapoyl sucrose

Sign In for Pricing
View Details
Dopropidil
orb1709843-01 25 mg

Dopropidil

Sign In for Pricing
View Details