Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ricinus communis CASP-like protein RCOM_0837390 (RCOM_0837390)

This Recombinant Ricinus communis CASP-like protein RCOM_0837390 (RCOM_0837390) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

CASP-like protein RCOM_0837390

UniProt

B9S8Z3

Expression Region

1-191

Origin

Ricinus communis (Castor bean)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTGSVEAGEQASEDATPRRGKKLNRGILILDLVLRVFGAICTLGSAVAMGTTSQTLPSS SQFFRFRAKYNDLPMFMFFAIANSIVCAYLVLSLRLSIFHIIRSAGIITRIILVTFDMVM LVLLTCGASAATSIVYLAHKGNASANWLPFCVRFSHFCNRISGSLIGSFFSIIIFMLLVI LSAVSQFSICN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Over-expression Lysate
LY402188 100 µg

Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Over-expression Lysate

Sign In for Pricing
View Details
4’-Hydroxyacetophenone Oxime
TRC-H741050-25MG 25 mg

4’-Hydroxyacetophenone Oxime

Sign In for Pricing
View Details
VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF405S conjugate, 0.1mg/mL
BNC042896-100 1x 100 µL

VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NFIL3 Human Gene Knockout Kit (CRISPR)
KN201537BN 1 Kit

NFIL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha-Phenyl-Alpha-(2-pyridyl)acetonitrile-d4
TRC-P336652-5MG 5 mg

Alpha-Phenyl-Alpha-(2-pyridyl)acetonitrile-d4

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left upper lobe
CR566351 5 µg

Tissue Total RNA, Lung: left upper lobe

Sign In for Pricing
View Details