Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR413C (YDR413C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR413C (YDR413C) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YDR413C

UniProt

P87266

Expression Region

1-191

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLHYLLRLLSFAFLWFILRSFLVKYLNFFTLGFFFCFSSTPRNFAYLVALFMLCLSTFS AFSNLTLFSWAKYSKLSLGSNVSNSTVVESSYISVIAPFFKIGFTLLSLLSLSPSSLSES NPCQDSSDSTCKSSVLSFFASSISASKFKLSLNVFNCSSITSLRSCRIFCLSSIFLSLSC SLINSCAFFCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3 Recombinant Rabbit monoclonal Antibody
IRS022 100 µL

CD3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Eph receptor A6 (EPHA6) (C-term) Rabbit Polyclonal Antibody
AP23642PU-N 50 µL

Eph receptor A6 (EPHA6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF640R conjugate, 0.1mg/mL
BNC402007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Pleura
CR560059 5 µg

Tissue Total RNA, Pleura

Sign In for Pricing
View Details
GW0742 Sulfoxide
TRC-G930010-2.5MG 2.5 mg

GW0742 Sulfoxide

Sign In for Pricing
View Details
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N 100 µg

BMP2 (aa 261-290) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details