Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ricinus communis CASP-like protein RCOM_0680180 (RCOM_0680180)

This Recombinant Ricinus communis CASP-like protein RCOM_0680180 (RCOM_0680180) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

CASP-like protein RCOM_0680180

UniProt

B9RT04

Expression Region

1-192

Origin

Ricinus communis (Castor bean)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSQNKNSVDAMDGIESRGMKERGGRTNSFLVLRVLAFVLTSTAAIVHGVNNQTETVPIQ LTSSMPPLYVPVVAKWHYLSAFVFFVVSNAIACSYAAISVMLSFCGKKSMVPIILTLDLL MVALLFSSNGAATAIGVMGYKGNSHVKWNKVCNVFGKFCNQVAASVVLSLIGSIVFVLLV MLTAFRLHNKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Kidney
CP565664 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
RAD51D Rabbit Polyclonal Antibody
TA380673 100 µL

RAD51D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(R)-6-Bromo Phenylephrine Hydrochloride
TRC-B686830-1MG 1 mg

(R)-6-Bromo Phenylephrine Hydrochloride

Sign In for Pricing
View Details
Recombinant CTIP1 Antibody
RC-5374-01 50 μL

Recombinant CTIP1 Antibody

Sign In for Pricing
View Details
Recombinant CTIP1 Antibody
RC-5374-02 100 µL

Recombinant CTIP1 Antibody

Sign In for Pricing
View Details
Recombinant CTIP1 Antibody
RC-5374-03 1 mL

Recombinant CTIP1 Antibody

Sign In for Pricing
View Details