Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb1617 (Mb1617)

This Recombinant Uncharacterized protein Mb1617 (Mb1617) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb1617

UniProt

P0A5F4

Expression Region

1-193

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGLSATGVLVGGLWAWIAPPIHAVVAITRAGERVHEYLGSESQNFFIAPFMLLGLLSVL AVVASALMWQWREHRGPQMVAGLSIGLTTAAAIAAGVGALVVRLRYGALDFDTVPLSRGD HALTYVTQAPPVFFARRPLQIALTLMWPAGIASLVYALLAAGTARDDLGGYPAVDPSSNA RTEALETPQAPVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MTHFR knockout cell line
ABC-KH9612 1 Vial

Human MTHFR knockout cell line

Sign In for Pricing
View Details
Gas2l2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6213507 1.0 µg DNA

Gas2l2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CSTB antibody - N-terminal region
MBS3214218-01 0.1 mL

CSTB antibody - N-terminal region

Sign In for Pricing
View Details
CSTB antibody - N-terminal region
MBS3214218-02 5x 0.1 mL

CSTB antibody - N-terminal region

Sign In for Pricing
View Details
GALP Polyclonal Antibody, HRP Conjugated
bs-11526R-HRP 100 µL

GALP Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Tapasin Related Protein (TAPBPL) Mouse Monoclonal Antibody [Clone 3D8]
E45M13258V-2 50 µL

Tapasin Related Protein (TAPBPL) Mouse Monoclonal Antibody [Clone 3D8]

Sign In for Pricing
View Details