What is the catalog number for Recombinant Glycine max CASP-like protein 7?

The catalog number for Recombinant Glycine max CASP-like protein 7 is orb2919031.

What sizes are available for Recombinant Glycine max CASP-like protein 7?

Recombinant Glycine max CASP-like protein 7 is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Glycine max CASP-like protein 7 come in?

Recombinant Glycine max CASP-like protein 7 is available in 2 different pack sizes.

Is Recombinant Glycine max CASP-like protein 7 in stock?

Recombinant Glycine max CASP-like protein 7 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Glycine max CASP-like protein 7

This Recombinant Glycine max CASP-like protein 7 spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

CASP-like protein 7

UniProt

C6SVQ5

Expression Region

1-193

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTDKPGGDPEYRTSSTPAPAGVDYFKFDVILRFLLFAASLVAVVVIVTANQTEVIRVP QPVPWPAKFRYSPAFVYFVAALSVTGLYSIITTLASLLASNKPALKTKLLLYFILWDALI LGIIASATGTAGGVAYLGLKGNRHVVGWNKICHVYDKFCRHVGASIAVALFGSVVTVLLI WLSAYSIHSRVPK