Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Uncharacterized protein TC_0274 (TC_0274)

This Recombinant Chlamydia muridarum Uncharacterized protein TC_0274 (TC_0274) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Uncharacterized protein TC_0274

UniProt

Q9PL34

Expression Region

1-193

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSTVAPVKGPDHFLNLVFPERVFASYMSPLAQKHPKAALYIASLAGFIFGLLKLITFPV LCAAGLFVFPIKGIISSLCHRRLDACSGYMLATFLSLFSLALIIVGIVSCVAWAPEFIFP IISIGMALATTETCFQIYTHLFPALEHKPSSPLKIENTTTKLSRSSSAPDLSCPSLSTQP TSPNQSLSAYKKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRK (NM_003806) Human Over-expression Lysate
LY401253 100 µg

HRK (NM_003806) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631500 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
GIP Human Gene Knockout Kit (CRISPR)
KN422456 1 Kit

GIP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708212 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PAPSS2 Polyclonal Antibody
E-AB-19076-01 20 µL

PAPSS2 Polyclonal Antibody

Sign In for Pricing
View Details
PAPSS2 Polyclonal Antibody
E-AB-19076-02 60 µL

PAPSS2 Polyclonal Antibody

Sign In for Pricing
View Details