Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Uncharacterized protein TC_0274 (TC_0274)

This Recombinant Chlamydia muridarum Uncharacterized protein TC_0274 (TC_0274) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Uncharacterized protein TC_0274

UniProt

Q9PL34

Expression Region

1-193

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSTVAPVKGPDHFLNLVFPERVFASYMSPLAQKHPKAALYIASLAGFIFGLLKLITFPV LCAAGLFVFPIKGIISSLCHRRLDACSGYMLATFLSLFSLALIIVGIVSCVAWAPEFIFP IISIGMALATTETCFQIYTHLFPALEHKPSSPLKIENTTTKLSRSSSAPDLSCPSLSTQP TSPNQSLSAYKKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Actn3 activation kit by CRISPRa
GA200050 1 Kit

Mouse Actn3 activation kit by CRISPRa

Sign In for Pricing
View Details
FNIP1 Antibody: HRP
SPC-718D-HRP 100 µg

FNIP1 Antibody: HRP

Sign In for Pricing
View Details
RIF1 Human Gene Knockout Kit (CRISPR)
KN423158 1 Kit

RIF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human HER2/ErbB2 Protein (His Tag)
PKSH032988-01 10 µg

Recombinant Human HER2/ErbB2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HER2/ErbB2 Protein (His Tag)
PKSH032988-02 50 µg

Recombinant Human HER2/ErbB2 Protein (His Tag)

Sign In for Pricing
View Details
Ceftiofur
TRC-C244695-1G 1 g

Ceftiofur

Sign In for Pricing
View Details