Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sulfurreducens Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Geobacter sulfurreducens Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P60926

Expression Region

1-194

Origin

Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNELILTAVAYIVGSIPTGLLLARASGVDIRATGSGNIGATNVYRTLGRTVGIATLLGD CLKGLVPVLVARKLGFADPWVAAVGLAAFLGHVYTIFLGFKGGKGVATALGVFLGVSPLS VLGALALFIGIVATTRYISLGSIIAAAAMPLFVAAVERRPLLVGMTLVIAVIVIVKHREN IRRLREGTENRFKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-500 1x 500 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/515), CF647 conjugate, 0.1mg/mL
BNC470515-100 1x 100 µL

CD79a (IGA/515), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF640R conjugate, 0.1mg/mL
BNC400828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details