Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus epidermidis Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

Q5HMY5

Expression Region

1-194

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIIDKKIEQFAQYLQRKNNLDHIQFLKIRLGMQVLAINIEKSIVVYGLAIIFHTFFYTL LTHLSYFLIRRHAHGTHANSSLLCHIQNIIFFIIFPYLIIKLDINYFVLLSMALVGLIIT ILYAPAATKKQPIPRRLVKRKKILSIFLYCTIVVISLVTKEPVNKLILFGVILESLTLLP IFFPKEDINHGKHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-tert-butyl Ether
TRC-D427235-500MG 500 mg

Di-tert-butyl Ether

Sign In for Pricing
View Details
CD4 Rabbit Polyclonal Antibody
ER1803-84 100 µL

CD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adenylate cyclase 1 (ADCY1) (aa 230-280) Rabbit Polyclonal Antibody
AP20473PU-N 100 µg

Adenylate cyclase 1 (ADCY1) (aa 230-280) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505193 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
IRAG1 (NM_001098579) Human Recombinant Protein
TP320170 20 µg

IRAG1 (NM_001098579) Human Recombinant Protein

Sign In for Pricing
View Details
Guanylmelamine Dihydrochloride
TRC-G416225-1MG 1 mg

Guanylmelamine Dihydrochloride

Sign In for Pricing
View Details